PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5NG331400.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 639aa    MW: 71725.2 Da    PI: 7.2026
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5NG331400.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS364.41.6e-1112676372374
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                          ++lL++cA+a + +d+++ ++lL+++++++s +gd+ qRla+yf+++L+arla+++s++y ++++++t    + + l+a+ l+ +++P++
  Pavir.5NG331400.2.p 267 TTLLIHCAQAAAIDDHRNSNELLKQIRKHSSATGDAGQRLAHYFANGLEARLAGTGSTIYCQIAAKRTC---TGDILKAFGLYAKACPFM 353
                          689*********************************************************999888887...899*************** PP

                 GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefn 179
                          k+sh   N++Il+  ++++r+HiiD++i +G+Q+p L+q ++ + +gppslRiTgv+ p++g   +e++e+tg+rL+++A+ ++vpfe++
  Pavir.5NG331400.2.p 354 KISHYFSNSTILNVSKSASRLHIIDYGIRYGFQYPVLMQRFSRKHGGPPSLRITGVDFPQPGfrPAERIEATGRRLHEYARMFDVPFEYH 443
                          *************************************************************9**************************** PP

                 GRAS 180 vlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfd 269
                          + +a +++++++e+L+++++E l+Vn+ +++ +++de+v+ +s+r++vL+++++l+P+++v+   +  +n++ F++rf ea+ ++s+ fd
  Pavir.5NG331400.2.p 444 A-IAGKWDSIQVEDLNINSDELLVVNCLYRMRNMMDETVTDDSPRTRVLNTIRKLNPHLFVHGIINGTYNAPFFVTRFKEAMFFFSSHFD 532
                          *.799************************************************************************************* PP

                 GRAS 270 sleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslv 359
                          +lea+++r +e+r  +Ere++gr++ nv+aceg+er+er et+++W++r  +aGF+p+pl+e+++k a++ +rk + + + v+e++++++
  Pavir.5NG331400.2.p 533 MLEANASRMDEHRLLIEREFVGRDALNVIACEGTERIERPETYKQWQMRNLRAGFRPLPLNEEVVKRARYKVRKSYHRDFLVDEDNKWML 622
                          ****************************************************************************999*********** PP

                 GRAS 360 lgWkdrpLvsvSaWr 374
                          +gWk+r L+++SaW+
  Pavir.5NG331400.2.p 623 QGWKGRVLTALSAWT 637
                          **************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.256240617IPR005202Transcription factor GRAS
PfamPF035145.6E-109267637IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 639 aa     Download sequence    Send to blast
MAMHPGSRSD LNFGDVFANS NPPTGRMINF SLQQQSQVQI FPSYGPHSHN PPVNSHPSPS  60
LAMPGGVTPS PASTTTTELD NSEDAVLAYI NQFLLEDEDD ESFPVTSAPV DDSALLAVEK  120
PFVDILKSAK PAQAYEGKSW MTGHCDIPGM GGLDDVVRHT QKSCQSPCEM VKEGSVCAAH  180
KGRKNPHDDG LEMEERKSKQ SALCEEETVR EMFDKVLLCT DENCEFRSPL PIDAQISSGY  240
VKGSGNRRGR RKGRSGAGLE EEAVDLTTLL IHCAQAAAID DHRNSNELLK QIRKHSSATG  300
DAGQRLAHYF ANGLEARLAG TGSTIYCQIA AKRTCTGDIL KAFGLYAKAC PFMKISHYFS  360
NSTILNVSKS ASRLHIIDYG IRYGFQYPVL MQRFSRKHGG PPSLRITGVD FPQPGFRPAE  420
RIEATGRRLH EYARMFDVPF EYHAIAGKWD SIQVEDLNIN SDELLVVNCL YRMRNMMDET  480
VTDDSPRTRV LNTIRKLNPH LFVHGIINGT YNAPFFVTRF KEAMFFFSSH FDMLEANASR  540
MDEHRLLIER EFVGRDALNV IACEGTERIE RPETYKQWQM RNLRAGFRPL PLNEEVVKRA  600
RYKVRKSYHR DFLVDEDNKW MLQGWKGRVL TALSAWTS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-472706368374GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.182640.0leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981240.10.0PREDICTED: scarecrow-like protein 30
SwissprotQ9XE581e-161SCL14_ARATH; Scarecrow-like protein 14
TrEMBLA0A0A9TYC80.0A0A0A9TYC8_ARUDO; Uncharacterized protein
STRINGSi034627m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-163GRAS family protein